SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene28770 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene28770
Domain Number 1 Region: 43-187
Classification Level Classification E-value
Superfamily POZ domain 3.77e-16
Family BTB/POZ domain 0.085
Further Details:      
 
Domain Number 2 Region: 274-376
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000133
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gene28770
Sequence length 696
Sequence
MDHMNDLSSSLSFASSYVSNGSSGNHVSASANSQSTEHLSLSRLSDNLERLLLDSQYDYS
DADIVVEGVPVGVNRCILAARSQFFHEHFKKGNDDSKKEGKPQYMMSELVPYGGVGCEAF
KVVLNYLYTGKLKPPPPEVSTVSTCVDDGCAHDSCGPAINYAVELLYAAATFQMKELVQV
VQRRLTNFVEKALVEDVIPILVASFHCKQNQLLSHCIQRVERSDLDNVVLEKELPHKVFI
NIKSLRLEYQKMADSIMVEMEPVEDKRLKSIRNIHMALDTDDVELVTRLLDESGSSTLDD
ACALHYAVAYCDPKIVKEVLGLRLGNTNLRNARGHTVLHVAARRKDPAVLVPLLNSGASA
LEITSDGQTAVAICRRLTRPKDYYENTKQGEVSNKDRICIDLLEREMQRNSMAVNMSNTS
YVMADDLPVRLDYFENRVAFARLLFPAEAKLAMEVADHPTTGYTGLPSKGSSGNLREVDL
NETPSVRSKRLQEKLQALIKTVEMGRRFFPQCSEVLDKFLDAMDMADYFLEKGTPEEQKN
KKMRFLELKDDVQKAFCRDVAAKQGSVLTASSSSSSSPKEGVNLAFVRLLFPAEAKLAME
VADHPTTGYTGLPSKGSSVEMGRRFFPHCSEVLDKFLEDQMNVADDFLDKGTHEEQKNKK
MSFLELKDDVQKAFWKDVAKKHGSVSTASSSSSSSP
Download sequence
Identical sequences gene28770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]