SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene29445 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene29445
Domain Number 1 Region: 194-293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-19
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 600-696
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-17
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 3 Region: 431-507
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.28e-16
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 4 Region: 22-116
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000149
Family B3 DNA binding domain 0.0051
Further Details:      
 
Weak hits

Sequence:  gene29445
Domain Number - Region: 389-430
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00667
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene29445
Sequence length 701
Sequence
MASSYVRRKCADHRPSSSATTPRRFLEVILDDTSRERKLRIPKSFLDIYGEDLSNWVYFK
LPYGPELDIGLTSFNGEVWFRKGWPEFSKLYSLEKGYSLIFGYEGNSRFQVSIFDGSNNM
EIDYTTRRMLGSEESDQDDDISLDISEDIRPNVDSEERVKKETHWSKSEMLRKNQFVAER
HGGGKARLFQRAKSYNCSFKVPMHSTYINHNLLWLPKAFVKTYLVKQPTDAALKISGGKK
SWPVKLRYEEAKGRVKFQSGWTDFVRDRSLKEGDICEFVLVDSKRHVFEVKITTANHTLS
PDIDDGNDEEDEQEDEDSDDESIEILDHFPPHLETKEKSPLESQPRKRKRHSSRTLIDIF
PEERPVVPRKMHPPITASSGKVPRANGFESANPDFKILLKPAYIHGNYLYMPAKFAKRYL
VKQPGHAILQKLPYKFVKKYGGELSSSASLKLPDGLEWEVDITRCDSKVWFEKGWENFSY
FYSIGHGHFLVFGYQGNSKFDVCIFDRTATEIDYSRTVEDDDSSGEILEDCLRGSRNSGS
VSRKKNRNNSTGKPEMDDNNDEGDVGSEEGEDEDNHSRRMHPVTSSIRKEIALQRAKDYE
PALPHFVIAIRTSSIPGGYLYVPSVFSKTYLATQPTHIMLQTVSNKEPWCVDMHYERSAC
RLRAGWPGFVKSNKLVLGDACVFVLKDSNAFLFDVVFYRAT
Download sequence
Identical sequences gene29445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]