SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene31944 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene31944
Domain Number 1 Region: 285-324
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000824
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 134-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000188
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene31944
Sequence length 325
Sequence
MSMQFDDFGGARRLVMGVEGNRWPNGKPQNVTAPSLLSRFVPSIYLFWSRVKARHRLGLR
NVLLASSCPVPTHIVSAIQHNSNHPELHSDQQLLRPHRSPHFGSSSRYNFIARNISLTDT
IHQQKEIAVLHSPLQEGWQEFLRDNAIGDSEFLVFGYDGNMHFSIDIYERTGCKRTVAPA
IQGHQRSTFTNNTKRLCGRPRKSGTAAEHTANGESSNNTKRHRGRQRLNTYTANGESGNN
NHVVDQEIFQQASVRSIFLLATTNSSWKIQREANGKQAVLLAMLQSNWVHGGWIGFARDN
GVEIGDDCLFELESKSKTVVHIIKK
Download sequence
Identical sequences gene31944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]