SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|426412311|ref|YP_007032410.1| from Pseudomonas sp. UW4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|426412311|ref|YP_007032410.1|
Domain Number 1 Region: 425-568
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.86e-30
Family Flavohemoglobin, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 321-419
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.58e-28
Family Ferredoxin reductase FAD-binding domain-like 0.00076
Further Details:      
 
Domain Number 3 Region: 557-668
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.08e-21
Family 2Fe-2S ferredoxin-related 0.031
Further Details:      
 
Domain Number 4 Region: 157-294
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0000000089
Family PNP-oxidase like 0.015
Further Details:      
 
Weak hits

Sequence:  gi|426412311|ref|YP_007032410.1|
Domain Number - Region: 32-123
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00785
Family NADH:FMN oxidoreductase-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|426412311|ref|YP_007032410.1|
Sequence length 676
Comment oxidoreductase, FAD-binding protein [Pseudomonas sp. UW4]
Sequence
MDRSPWHSGEKQLQAHVGVAERMEVFGRKVIRSEMPDQHRTFYQQLPFMLYGAVDADGHP
WASILEGQPGFAHSPAPGLLQFSSLPAFDDPAQLIDGAAIGLLGIELHTRRRNRINGHVR
AMTTGGFAVTVDQSFGNCPQYIQLRQFRSVPLADPSTRVAQHFNELDEAAKAMIAEADTF
FVASYVEVDGERSVDVSHRGGQTGFVHVEGNRLTIPDFAGNLHFNTLGNLLLNPRAGLLF
IDFNTGDLLQLSGRTEIILEGPQVEAFQGAERLWTIDVEHVVRRPAALALRWRFDGVSPT
SLLTGSWEQAAARLQAKALGDQWRPLRVTRIEEQSHSIRSIYLEPADGAGLPLFQAGQHL
PLRLNIDGEVHIRTYSLSSAPSDDFFRISVKRDGRVSTHLHERIRVGDLLEARAPQGHFT
VASHERRPLVLLAAGVGITPLLSMLREVVYQGLRTRRIRPTWFIQSSRTLADQPFRRELD
RLLEDAGDAVRVVRLLSQPEAEAVQGADFDLSGRIDVALLKELLTVEDYDQPDFVVCGPG
SFTQALYDGLRELDIRDSRIHAETFGPSTLRRRPDPDAVVIEQPPAATTSVPVVFQRSAK
EARWQPEGGSLLELAESRGLRPEFSCRGGSCGTCKTRLVSGQVHYPLPPAEVPDDGQVLI
CCAIPAQGAQPLVLDI
Download sequence
Identical sequences K9NTE8
gi|426412311|ref|YP_007032410.1| WP_015097434.1.62707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]