SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345017378|ref|YP_004819731.1| from Thermoanaerobacter wiegelii Rt8.B1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345017378|ref|YP_004819731.1|
Domain Number 1 Region: 4-152
Classification Level Classification E-value
Superfamily YutG-like 3.92e-53
Family YutG-like 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345017378|ref|YP_004819731.1|
Sequence length 157
Comment phosphatidylglycerophosphatase A [Thermoanaerobacter wiegelii Rt8.B1]
Sequence
MKDIAINLLEERGVTLEDMAVLVLDLQKKYYDDLTIEECIENLHHVLEKREVQNAILTGI
ALDKLAEKDMLEEPLLSILKKDEPLYGIDEILALSITNVYGSIGLTNFGYLDKVKPGIIG
KLNEDKEKKCNTFIDDLVAAIIAAACARIAHSKKEVL
Download sequence
Identical sequences A0A1G7JY94 G2MR37 I9AHH1 M8DD62
gi|345017378|ref|YP_004819731.1| WP_004405273.1.2831 WP_004405273.1.87327 WP_004405273.1.88059 WP_004405273.1.89381 WP_004405273.1.89705 WP_004405273.1.96823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]