SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345017556|ref|YP_004819909.1| from Thermoanaerobacter wiegelii Rt8.B1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345017556|ref|YP_004819909.1|
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily YheA/YmcA-like 3.4e-31
Family YheA-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345017556|ref|YP_004819909.1|
Sequence length 109
Comment hypothetical protein Thewi_1202 [Thermoanaerobacter wiegelii Rt8.B1]
Sequence
MNVYDKAYELANAIRQLPEYKAFKEAYQKINENEQNKKMLEDFRKKQLEIQAKELSGEKV
DPKEKEVLEKLWEILNLNPELSSYLSLEYTLGKIMDDILKIIMEPMEMK
Download sequence
Identical sequences A0A1G7HCG5 F1ZUI6 G2MT39 I9AGY2 M8DJM4
WP_003869801.1.2831 WP_003869801.1.87327 WP_003869801.1.88059 WP_003869801.1.89381 WP_003869801.1.89705 WP_003869801.1.9077 WP_003869801.1.96823 gi|345017556|ref|YP_004819909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]