SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345017777|ref|YP_004820130.1| from Thermoanaerobacter wiegelii Rt8.B1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345017777|ref|YP_004820130.1|
Domain Number 1 Region: 18-178
Classification Level Classification E-value
Superfamily RNase III domain-like 8.37e-53
Family RNase III catalytic domain-like 0.0000331
Further Details:      
 
Domain Number 2 Region: 129-246
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.38e-25
Family Double-stranded RNA-binding domain (dsRBD) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345017777|ref|YP_004820130.1|
Sequence length 246
Comment ribonuclease 3 [Thermoanaerobacter wiegelii Rt8.B1]
Sequence
MGHYFLKNFKRGMEVKRENLSELEKRINYSFKDKNLLIEALTHSSWAHEGKNSKISNERL
EFLGDSVLSLVISEYLYKNRKDLEEGSLSKYRAEIVCEPSLARCAREIELGNFLRIGKGE
ELTGGRERDSILADAMEAILAAVYLDGGLEVVRNVILELFKNIIEEVLEGLIYRDYKTKL
QEVVQSMEIGKIIYELIEEMGPDHNKTFVTQVRIGDVILGKGYGKSKKEAEQAAAMEALI
KLGILK
Download sequence
Identical sequences A0A1G7UKV0 B0K9X5 E8UTH6 F1ZSM8 G2MXH6 I8R0T2 M8CT30
WP_003869194.1.2831 WP_003869194.1.2934 WP_003869194.1.56562 WP_003869194.1.87327 WP_003869194.1.88059 WP_003869194.1.89381 WP_003869194.1.89705 WP_003869194.1.9077 WP_003869194.1.96823 340099.Teth39_1284 gi|320116111|ref|YP_004186270.1| gi|167037696|ref|YP_001665274.1| gi|345017777|ref|YP_004820130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]