SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345018517|ref|YP_004820870.1| from Thermoanaerobacter wiegelii Rt8.B1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345018517|ref|YP_004820870.1|
Domain Number 1 Region: 81-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-27
Family Translational machinery components 0.00016
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.23e-21
Family Ribosomal S5 protein, N-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345018517|ref|YP_004820870.1|
Sequence length 167
Comment 30S ribosomal protein S5 [Thermoanaerobacter wiegelii Rt8.B1]
Sequence
MARVDWTKLDLKERVVSINRVAKVVKGGKNFRFSVTVVVGDADKGYVGVGRGKAAEIPDA
IRKAIEDAKKHLIKVPIVGTTIPHEVIGEFGAGKVLLKPAREGTGVIAGGPVRAVLESAG
IKDVLTKSLGSSNATNMVYATIEGLKRLRTAEEVARLRGIPVSQLFE
Download sequence
Identical sequences A0A1G7RZ85 G2MWW0 I8QXM1 M8DEG7
gi|345018517|ref|YP_004820870.1| WP_004402350.1.2831 WP_004402350.1.87327 WP_004402350.1.88059 WP_004402350.1.89381 WP_004402350.1.89705 WP_004402350.1.96823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]