SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470159875|ref|YP_007531804.1| from Corynebacterium callunae DSM 20147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470159875|ref|YP_007531804.1|
Domain Number 1 Region: 51-193
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.87e-60
Family DIP2269-like 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470159875|ref|YP_007531804.1|
Sequence length 193
Comment hypothetical protein H924_12400 [Corynebacterium callunae DSM 20147]
Sequence
MRRTLPISAFSSIMLATVMASCSSPAPETSATATPAAPVTPAEVTDGVGVDKLPFDAMPT
VAREAQVACPYLDTEWVAETNGQRVTGYGTDESFSTPACVYYSFPEEPQLTVIVREMDSV
AEATQVVDWAAPIDSTEPAEEPAGWSGGRGGGQGQGALYAVSKNNTAVVVFSNQEQSLKA
QLVAEEVIKNLGL
Download sequence
Identical sequences M1TUL9
WP_015652327.1.59433 WP_015652327.1.7153 gi|470159875|ref|YP_007531804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]