SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385774905|ref|YP_005647473.1| from Sulfolobus islandicus REY15A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385774905|ref|YP_005647473.1|
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.3e-31
Family GHMP Kinase, N-terminal domain 0.0000731
Further Details:      
 
Domain Number 2 Region: 168-290
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.52e-23
Family Homoserine kinase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385774905|ref|YP_005647473.1|
Sequence length 311
Comment homoserine kinase [Sulfolobus islandicus REY15A]
Sequence
MECKRARAYSSSANLGSGFDILSMAHTAFFDTVEICVETKNSENIVIESNSKIPLEPNRN
SATYPLVRIMEERGIKASLRVKVIKGIPEGLGLGSSGASATAAVMAFSSLFNLNLSKEDL
VRYAMYGEIASSGSPHPDNVAASVFGGVVSVVSVNPVKVVEIPLNYSFNILLFVPLNVHI
EEKTKKAREMVPKTVKLSDYINNSRYISSLLIGFVKGERDLIRLGLNDEIVEKARLPLFP
YYPKIKEIAIKYDAVGSCVSGAGPSILVLTDKMTDENKIAEEGTKTCNEFNVECEVIKAK
IAGGVEVERRN
Download sequence
Identical sequences C3MK52 C3MU21 C3N0N3 C4KK76 F0NBB2 F0NJ28
gi|385772190|ref|YP_005644756.1| gi|229583738|ref|YP_002842239.1| gi|385774905|ref|YP_005647473.1| gi|227826574|ref|YP_002828353.1| 426118.M164_0183 427317.M1425_0164 427318.M1627_0164 429572.LS215_0195 WP_012710342.1.100559 WP_012710342.1.27011 WP_012710342.1.27461 WP_012710342.1.44962 WP_012710342.1.47130 WP_012710342.1.48461 WP_012710342.1.60638 WP_012710342.1.66823 WP_012710342.1.67233 WP_012710342.1.68242 WP_012710342.1.74483 WP_012710342.1.83431 WP_012710342.1.84481 WP_012710342.1.89621 WP_012710342.1.90709 WP_012710342.1.91160 WP_012710342.1.97021 gi|238618660|ref|YP_002913485.1| gi|227829216|ref|YP_002830995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]