SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385775987|ref|YP_005648555.1| from Sulfolobus islandicus REY15A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385775987|ref|YP_005648555.1|
Domain Number 1 Region: 8-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-46
Family Ribonuclease PH domain 1-like 0.000000176
Further Details:      
 
Domain Number 2 Region: 153-240
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.58e-25
Family Ribonuclease PH domain 2-like 0.00000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385775987|ref|YP_005648555.1|
Sequence length 245
Comment exosome complex exonuclease 1 [Sulfolobus islandicus REY15A]
Sequence
MLQVERPKLIFEDGKRIDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAAVYGPKE
MHPRHLSLPDRAVLRVRYHMTPFSTDERKNPAPSRREIELSKVIREALESAVLVELFPRT
AIDVFTEILQADAGSRLVSLMAASLALADAGIPMRDLIAGVAVGKADGVIVLDLNEPEDM
WGEADMPVAMMPSLNQVTLFQLNGNMTPEEFRQAFDLAVKGINIIYNLEREALKSKYVEF
KEEGV
Download sequence
Identical sequences F0NF61 M9U6U3
WP_014513959.1.67233 WP_014513959.1.91160 gi|479325664|ref|YP_007865719.1| gi|385775987|ref|YP_005648555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]