SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385776400|ref|YP_005648968.1| from Sulfolobus islandicus REY15A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385776400|ref|YP_005648968.1|
Domain Number 1 Region: 17-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000106
Family GHMP Kinase, N-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 208-251
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000863
Family Homoserine kinase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385776400|ref|YP_005648968.1|
Sequence length 268
Comment shikimate kinase [Sulfolobus islandicus REY15A]
Sequence
MQTYGGVSIINALPSWYGSSMAVNLKVKVEIKEGKRDYSKESDLIRVIIDYFKEKYSIPD
IVVDIESELPQKSGLKSSSAVSVALIAEIAKRYNLRNINPPVLSAILSLKAGVSYTGALD
DATASYCGGIAFTYNKMFRIVKLDNSEDDLSVLILARGGRQKSVNLNELRKYNHVFEEIF
RIALKDSLTAMKINGILIANILGYPLDPIEIALKNGALAAGISGNGPSYFAVSRYGEEGP
IYESLKRFGDVIIARPVSLDCKDLSIRD
Download sequence
Identical sequences F0NIG7 F0NRG7
gi|385773765|ref|YP_005646332.1| gi|385776400|ref|YP_005648968.1| WP_014512824.1.27011 WP_014512824.1.67233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]