SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385776950|ref|YP_005649518.1| from Sulfolobus islandicus REY15A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385776950|ref|YP_005649518.1|
Domain Number 1 Region: 177-322
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.32e-46
Family Mevalonate 5-diphosphate decarboxylase 0.0005
Further Details:      
 
Domain Number 2 Region: 3-169
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.9e-38
Family GHMP Kinase, N-terminal domain 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385776950|ref|YP_005649518.1|
Sequence length 325
Comment diphosphomevalonate decarboxylase [Sulfolobus islandicus REY15A]
Sequence
MLKSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSDKNIVIVN
ERILPEDEMKEYAGRVLEAFKKIVGKEFNVKVESKAKFPVNAGLASSAAGIAALTFGLNE
LLELELKPEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSELVD
IIPILSEKEKKISSRKGMIRSAETSELMECRLKFVEKTFNEVIEAIRNRDERKFYYLVMR
HSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAGYTFDAGPNPHIFTTERYVQDVLE
FLKSLEIKRIIVSKVGDGPKILNRE
Download sequence
Identical sequences F0NCT0
gi|385776950|ref|YP_005649518.1| WP_014514238.1.67233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]