SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|455738729|ref|YP_007504995.1| from Morganella morganii subsp. morganii KT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|455738729|ref|YP_007504995.1|
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily YccV-like 1.44e-27
Family YccV-like 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|455738729|ref|YP_007504995.1|
Sequence length 106
Comment hemimethylated DNA binding protein YccV [Morganella morganii subsp. morganii KT]
Sequence
MMISSKFGIGQQVRHKLLGYLGVIVDIDAEYSLDQPEEDDIASNMNLRSAPWYHVVMEDD
NGEPIHSYLAEAQITYEMDEDHPDNITMDELAESIRNQLQSPRLRN
Download sequence
Identical sequences A0A1K3E1G2 A0A1M7GXA3 J7SL04
gi|455738729|ref|YP_007504995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]