SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|455738712|ref|YP_007504978.1| from Morganella morganii subsp. morganii KT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|455738712|ref|YP_007504978.1|
Domain Number 1 Region: 8-136
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 1.01e-27
Family MOSC N-terminal domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 288-372
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.87e-20
Family 2Fe-2S ferredoxin-related 0.023
Further Details:      
 
Domain Number 3 Region: 5-54,151-268
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000000000000136
Family MOSC (MOCO sulphurase C-terminal) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|455738712|ref|YP_007504978.1|
Sequence length 374
Comment Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Morganella morganii subsp. morganii KT]
Sequence
MTTTPITLSRLYTFPVKSMKGIRQSQSHAGETGLGFDRNFMITDETGKFITARRYPQMVL
FTPVLLSNGIYLRSPEGSGATILFEDFRPDHLPCEVWGNHFTSLLAPEKINQWLCQFFDI
PVQLRWLSPQSTRRVKKFPDTAVSFADGYPYLVVNEASFREVQRRCGAGIKIEQFRGNII
VTGAEPFAEDRWKTIQVGDVVFDLKKPCSRCILTTVSTDKGIKHPEMEPFHTLQTFRKAA
DNDDVDFGMNAIARNSGVIQVGDTVTVLETCKPRQYEEQIVEKVQAAPAQPEAALELIFN
GKLYPVNNQHILLEQLEGHQVNIPYSCRAGVCGCCKVTLVSGEVTPLKAGAIKENGDILA
CSCIPKTNITIRHG
Download sequence
Identical sequences A0A2C5TEE1 M1RJW6
WP_015422579.1.28595 WP_015422579.1.73677 WP_015422579.1.80621 gi|455738712|ref|YP_007504978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]