SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_01501-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_01501-P1
Domain Number 1 Region: 348-383
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000471
Family Rho termination factor, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_01501-P1
Sequence length 387
Comment pep:novel supercontig:GCA_000347455.1:scaffold8741:11446:14370:1 gene:TRIUR3_01501 transcript:TRIUR3_01501-T1 description:"SAP-like protein BP-73 "
Sequence
MTGAAPALLHHHGVSSRGTLPVYHGNCRFVPGSCFLSKSTILGPLTVSLVCGASPNNHRP
RNPDISRQQKRGSSSRGKSKPFQERDDSENNDEFDSDTVSSKNGPPMSLTSNSRPHATSA
PGEREKEIVELFKRVQAQLRARGKGREDKKPEPAKSQGEKGSVDSLLNLLRRHSVDQKRK
SSDEKEQNFDQTWRSSDSGNKQSSRIFGTKNDVQEGQKPPPATFQRPPSSFRRRSPVPGV
KFQLVTNPEAGAKPVVNGMTDAVLKAKTPLEEETAQDEPDSVSPYEPDSVLAPEDASLDD
FVVSDDESDVLDADEPEDYLEPLDDVDDIPDSSASLDDSLEGSPSAEASDLSSLKVTELR
ELAKSRGLRGYSKMKKGDLVALLRDAS
Download sequence
Identical sequences M7YSH3
TRIUR3_01501-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]