SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_21279-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_21279-P1
Domain Number 1 Region: 132-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000143
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_21279-P1
Sequence length 228
Comment pep:novel supercontig:GCA_000347455.1:scaffold71126:35540:38094:1 gene:TRIUR3_21279 transcript:TRIUR3_21279-T1 description:""
Sequence
ASRVSPDTMAKCRICRQYWRHLVKHHGYADPRRCRAPSHHRQSSSSSAAMTQSRARVEPR
RQAPVSSSSTTATNSESQQGEEYEHLEYIIRGPPPAIQYCGELEKYCHWGNEVKLYRRHV
DKLYAMFPRKKPDIKYYVCTVNKTFAQQGQRMYFQVHYTKENLKKYINPDDDMLKVKLVN
SSLHTNCCIMLGTEKRATITRNWSEFRRCANIHEGDICAFHFNLTTEH
Download sequence
Identical sequences T1MTK7
TRIUR3_21279-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]