SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_03112-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_03112-P1
Domain Number 1 Region: 294-369
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000314
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 116-209
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000196
Family B3 DNA binding domain 0.011
Further Details:      
 
Weak hits

Sequence:  TRIUR3_03112-P1
Domain Number - Region: 60-91
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0275
Family B3 DNA binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_03112-P1
Sequence length 372
Comment pep:novel supercontig:GCA_000347455.1:scaffold106884:38691:40707:-1 gene:TRIUR3_03112 transcript:TRIUR3_03112-T1 description:""
Sequence
MGLSSNCAKTIKIQQCVKLPDSKYLHINDELAGCFGTEDHGDGRTALVLSPFGKNVWPVK
FVAAHGIGVGWYLVIRHEGCGVLTLKAFDASFVIKEFGLTITVLSPAEIENAFARKPQFI
VPLQRSFMEKMPIPPEFLQRGYISEEDLNRPRPIATFLTSWHIELKKDGPNVFFTGSEWP
KFLAYFEIAETDVLLIKYQGCMNFSFETFQNGNNEHIEEKTSSSQQSEQSPGAQSQEEEH
VCSRKRKQSEVKSMLDGSTTSQHRKKALCELGSTGSQAWLRKEINELALKRYLHFPARFG
FLERCKITLKSVERNKSWEVEGVNYHPGTSRSYNCLTRGWKAFCKENELKAGDICTFKVV
NSTLWHVVIDHC
Download sequence
Identical sequences T1LER8
TRIUR3_03112-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]