SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_08026-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_08026-P1
Domain Number 1 Region: 280-401
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-24
Family cAMP-binding domain 0.0000106
Further Details:      
 
Domain Number 2 Region: 68-174,224-281
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000432
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_08026-P1
Sequence length 508
Comment pep:novel supercontig:GCA_000347455.1:scaffold27457:28609:32500:-1 gene:TRIUR3_08026 transcript:TRIUR3_08026-T1 description:"Putative cyclic nucleotide-gated ion channel 17 "
Sequence
MALGRQRTVRFYDERAKPAIPIQQKQAAFAASKLGVASSGKNKIFVGGDAQQYKIFDPSR
DLVTDPKEIAWKYLRSDFAIDVVAALPLPQMCYIKHEIIIVWYVIPAIKYSGAEHNNNIL
VLIVLAQYLPRLYLIFPLTYEIVKATGVVAKTAWEGAVYNLLLYLIASHVRNESDCNIRY
LDCDTPNQTWASTTDLFSRCNASNDSITFDYGMFQPALSNQAPAQGFLRKFFYSLWWGLQ
NLSCYGQTLSVSTYIGETLYCIFLAVLGLVLFAHLIGNVQVPFFSQMDDQLLDAICVRLV
SSLCTKGTYIVREGDPVAEMLFIIRGKLESSTTNGGRTGFFNSTTLKAGDFCGEELLGWA
LVPKPTASLPSSTRTVRAQIEVEAFSLQAEDLKFVASQFRRLHSKKLQHTFRYYSHHWRT
WGACFIQAAWRRYRRRKMAKDLSMRESFHSMRSEDSDGEDDPPPKKNISLRMMAGKVMAG
NRKGLQAIKELPTLKKPDEPDFSLEPYE
Download sequence
Identical sequences M7ZR91
TRIUR3_08026-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]