SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_09112-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_09112-P1
Domain Number 1 Region: 5-95,175-405
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.44e-81
Family IF2B-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_09112-P1
Sequence length 414
Comment pep:novel supercontig:GCA_000347455.1:scaffold25805:27854:46732:1 gene:TRIUR3_09112 transcript:TRIUR3_09112-T1 description:""
Sequence
MPDMQPLISDFVLKLKRRKVEGSHAVARQTAELLRSVVSQHRMGSTNQAAALADAIHAVG
EHLIAANPIELAVGNTVRRVLHIIKEEDISFTAVGIEGLSVTAVSDDECDSGNDDLPTLS
AAVLASHARNALRAPSLQTLLDDIPVSTALSHSSSSAGDSDGKTAGDKSLKTRKLKHDVI
AAIGDLIEEIDTCYDQISEQAVEHIHQNEVILTLGRSRTVKEFLYAAKEKKRSFRVFVAE
GAPRYQGHVLAKELVEKGVQTTVITDSAVFAMISRVNMVIVGVHAIMANGGVIAPVGMNM
VALAAQRHAVPFVVVAGSHKLCPLYPHNPEVLLNELKSPSDLLDFGEFSNCMNFSTQDGT
PLLNVANPTFDYVPPKLVSLFITDTGGHSPSYMYRLISEYYSADDLVVRQKSTS
Download sequence
Identical sequences T1LVQ3
TRIUR3_09112-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]