SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_11210-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_11210-P1
Domain Number 1 Region: 334-525
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.18e-32
Family cAMP-binding domain 0.000017
Further Details:      
 
Domain Number 2 Region: 141-196,268-368
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-18
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_11210-P1
Sequence length 605
Comment pep:novel supercontig:GCA_000347455.1:scaffold2921:71373:78350:-1 gene:TRIUR3_11210 transcript:TRIUR3_11210-T1 description:"Putative cyclic nucleotide-gated ion channel 15 "
Sequence
MASGASRTVSSGRVAGCRFRFQSDVDVKHFRASPLESPQPPSAGRKRSRSHDPRRCWPGS
RDSLEKPHPRTSGGRALKDRVLSRAFSEELESLMHAGGDRHLFFFFAPRGQFVVWVVVPK
LRESAITNMKNVLRFSIIFQYLPRLLQIFPLTRRIVMATGVMTENAWAGAAYNLILYMLA
SHVLGALWYLFSVQRQESCWRRACRVEGPPCQDIFFDCASTSTVVSSNRNRSVWYALTNV
TRLCAPGNNGFYQFGIFGEAVDAQLTTSSFTHKYFYCFWWGLKNLSCLGQNLNTSLSIGE
ISFAIVIGVLGLVLFALLIGNMQSYLQATMVRLEEWRTKRTDMERWMQHRQIPQPLKECV
RRYHQYKWVATRGVDEEALLEDLPMDIRRDIKRHLCLDLVRRVPLFDEMDERMLEAICER
LRPALYTRGTRLVRELDPVDSMLFIIRGHLDSNTTQGGRSGFFNSCRIGAGEFCGEELLT
WALDPRPAEALPRSTRTVRAVSEVEAFALVADDLRFVASQFRRLHSARIRHRFRFYSHQW
RTWAACFIQAAWRRHKRRRASMELRVREGGSDAWPGGSVRRRRHSCDGKALKKPTEPDFT
VEQED
Download sequence
Identical sequences M7ZUE9
TRIUR3_11210-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]