SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_13571-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_13571-P1
Domain Number 1 Region: 419-512
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-17
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 82-176
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.53e-16
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 3 Region: 229-333
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.65e-16
Family B3 DNA binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  TRIUR3_13571-P1
Domain Number - Region: 56-83
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0484
Family 2Fe-2S ferredoxin-related 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_13571-P1
Sequence length 521
Comment pep:novel supercontig:GCA_000347455.1:scaffold101421:13100:16469:-1 gene:TRIUR3_13571 transcript:TRIUR3_13571-T1 description:""
Sequence
MEERTPLSVATSTLAEATWKENRGRQLVDGRPRPVRETAHGDKGQEKSLVNFLATMACSN
GMCTSCECCKRRDEYYYRNLDDEKKYFLVLLIGDFRDEMIIPEELVRRFKRDILGEIKLE
TRNGDNHAIVVAKIEEKRIFTVGWRQFVANYDLQIGDLLMFRYKGNSQFNVIIFDKLGRE
KASSVVLDPFIPRVQDRGNEAHEIGSSEKMDVQCGRCNNWLEYHYANLDNENKYFLMLMM
GDFQYEMVIPEGILQRFKGEFPREIKLETQNRRSNKIGVTENKLDICYNQKLVFSVGWGK
FVETFGLQTGDTIVLIYNGNSQFSVIIFDKHGCEKALSVIVDPVPPPVQERRPYGGSLSS
EHGQGVRDVPVSSNIVKRKAKLSSSQKEQLRDGYITAHKTKLTLAQKDVVKQKVQSLESK
ISIFVAVMYKCNVESPFFLTFPNYYAQKYLGEEARMHLELLGVKWQVRFPNNRGDKKLKH
GWKQFVQGNNLKMGDICLFELLSNQSTMVVYVIPANDANVD
Download sequence
Identical sequences T1M7Q4
TRIUR3_13571-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]