SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_14094-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_14094-P1
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.05e-22
Family Ubiquitin-related 0.0008
Further Details:      
 
Domain Number 2 Region: 261-327
Classification Level Classification E-value
Superfamily XPC-binding domain 1.24e-19
Family XPC-binding domain 0.00054
Further Details:      
 
Domain Number 3 Region: 324-397
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000033
Family UBA domain 0.0025
Further Details:      
 
Domain Number 4 Region: 149-208
Classification Level Classification E-value
Superfamily UBA-like 0.000000000272
Family UBA domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_14094-P1
Sequence length 610
Comment pep:novel supercontig:GCA_000347455.1:scaffold248302:49605:55654:1 gene:TRIUR3_14094 transcript:TRIUR3_14094-T1 description:"Putative DNA repair protein RAD23 "
Sequence
MKVSVKTLKGSKFEIEVNPADKVSDVKKLIETSQGQNVYPADQQMLIYQGSVLKDETTLE
ENKVVENNFLVIMLRQNKGSSSAAPAKSKEPSNQAPPTQTVPATPASQAPATPAPQAVAA
PAPIVPVSAPGPAATASPAPAVAVSTEAETYGQAASNLVAGGTLEATIQSILEMGGGTWD
RDTVLRALRAAFNNPERAVEYLYSGIPEPMEIPAPPPSAQPADPALASQAAQPAVASSGP
NASPLDLFPQALPNASANAAGEGNLDVLRNNAQFRSLLSLVQANPQILQPLLQELGKQNP
QILQLIQDNQAEFLRLINEPAEGDEDENLLEQFAEGVPQTIAVTPEENEAILRLEGMGFD
RALVLEVYFACNKDETLAANYLLDHMNEFDDGAPQYPGSFASEQAWNPLGGLCCQIREIT
ILQFLKRLASRTDLEPVFLGKLSPWGLGTVKNPTIVNAHRSRKSHICHFEHVALQKCHTQ
YGLCKNATQLVEKGAQTSCLVSTATFENFYCWKKGGGAAPPRQRRGPLAPRSRRLAGDLA
RVEPWLMAGSNPSWVSVEPPSVGRAHEPCVRGGPTGWGQVKTTPARRPIDPPHLFCGSID
GDRLPKIQHH
Download sequence
Identical sequences M7YSY2
TRIUR3_14094-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]