SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_14458-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_14458-P1
Domain Number 1 Region: 2199-2475
Classification Level Classification E-value
Superfamily BEACH domain 1.29e-102
Family BEACH domain 0.0000000488
Further Details:      
 
Domain Number 2 Region: 2597-2666,2707-2822,2861-2908
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.02e-29
Family WD40-repeat 0.0065
Further Details:      
 
Domain Number 3 Region: 2105-2184
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000738
Family PreBEACH PH-like domain 0.015
Further Details:      
 
Domain Number 4 Region: 394-576
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000538
Family Clostridium neurotoxins, the second last domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_14458-P1
Sequence length 2934
Comment pep:novel supercontig:GCA_000347455.1:scaffold18875:100698:122833:-1 gene:TRIUR3_14458 transcript:TRIUR3_14458-T1 description:"BEACH domain-containing protein lvsC "
Sequence
MVVSSQETSTGTSAPLPTPRQQGSEAEQFAAVPLTEEVVAEEGVLSQETTTETPAPPSVP
QEQGSVQTFAAVSLTDEVGVEKGTSTPKLSTGTPEPLPVPQEQGSVQQFAAVSLSEEVGV
EKGTSTPKMSTGTPEPSPVPQEQGSVQQFAVVSLSEEVGVEKGTSTPKMSTGTPTMPPDP
SPPLRSRHRPPGVPADAPQEVVRAVDAAVMGNRGGRVDCLLEMVSEGQGELPHSVVDVLL
GTMGGVDGLDEVRDTTGTGTSPSIMSNSGAAITAAELLPHLPCSEEPSPRTRMAVGLHAA
LRACTRNRAMCSSSGLLAVLLESAEKLFVGTGGGSTSSWDGTPLLQCIQLLGGHSLSVKD
LHSWLGLVKKVLGTSWATRLMLALEKAMGSEEARGPAATFEFDGESSAATSGKSSAMSAA
AAASALAGEGTTHMPRLFSFLSSDNQGVEAYFHGQFLVVESGGGKGKKASLHFTYAFKPR
RWYFVGLEHTNKHGLLGKGDSELRLYVDGSLHESRAFDFPRISKPLAFCCIGTNPPPTIA
GLQRRRRQCPLFAEMGPIYIFREPIGPDRMSRLALRGGDILPTFGNGAGFPWKATNDHIK
NMAEESFALNHEIGGCLHLLYHPSLLSGRFCPDASPSGTHRRPAEVLGLVHVSPCVRPAE
SLWALAYGGPMALLPLTVSSVQMDTLEPALGELSLSLATASLSAPIFRIISLAIQHPGNN
EELCRTCAPELLSRVLHYLLQASSKLGSGEEEGVTNEELVAAIVSLCQSQRNNHELKVQL
FRTLLLDLKMWSSCNYGLQKKLLSSLADMVFTESICMRDANALQMLLDGCRRCYWAIREP
DSIDNLPLTGTKRSLGEVNALIDELLVVIELLLGAVSSASASDDVCSLIGFIVDCPQPNQ
VNGTYHCKYIDCMLLKIVARLLHLIYRLIVQPNISRANMFAQSFISSGGVEALLVLLQRE
AKAGNNHILDNSANLSECYVVSNEGSDAKATTGEGYYQDDESQLAEQHESIVHEDTEQEA
AKTNGASFKMLGAKIGRKISNSENQLVKNLGGINFSITADNVRNNVYNVDKGDGIVVGII
RILGALVASGHLKFASSPSNPNLPDGLLTTVHDEGNTMSEDRVSLLLFALQKAFQAAPRR
LMTANVYMALISAAINVSSADENLNLYDCGHRFEHIQLLLVLLRALPYAPRSFQARAIQD
ILFLACSHPENRTTMTTIAEWPEWILEVLIYIHEKGSKKYVDGVSIGEIEDLVHNFLIIM
LEHSMRQKDGWRDVEATIHCAEWLSMVGGSSTGDQRLRREQSLPIFRRRLLGDLLDFSAR
ELQVQTEVIAAAAAGVAAEGLSPEEAKVQAENAAHLSVALAENAIVILMLVEDHLRTQGQ
HFCVSRVLNSVFSSASIASSAPNRTNSLSRAGSEHMDTGLSRRSSLSSDAGGLPLDVLTS
MADANGQISAAVMERLTAAAAAEPYESVKHAFVSYGSCIADLAESWKYRSRLWYGVGVPS
KSDLFGGGGSDLESWRSVLEKDSNGNWVELPLVKKSLEVLQALLLDDSGLGGGLGIGGGS
GPGMGVMAALYQLLDSDQPFLCMLRMTLVSMREDDNGEGDALLKNTSIKDVISEGSLVPF
DGNSHSSTRKPRPALLWSVLGPILNMPITESKRQRVLVASSILYSEVWHAIGRDRSPLRK
QYIELILPPFIAILRRWRPLLAGVHELTSYDGRNPLIADDRALAADALPIEAALSMISPG
WAAAFASPPVAMALAMMAAGASGTETVTPRRNTLSRHDTSLPERKAAARLQTFSSFQKPV
ETMHNKPGSIPKDKAGAKAAALAATRDLERTAKIGSGRGLSAVAMATSGQRRSASDIDRA
KRWNTSEAMSAAWMECLQSADSKPVSGREFSTLSYKYVAILVSGFAFARNLQRVEMERQT
QVDVLNRHHASTGVRAWRHLLHCLTEMGRLYGPFEEPLCTPDRIFWKLDFTEGSSRMRRF
MKRNYKGSDHLGAAADYDDRKLLSADVQSNECNPKGADSSLTDTIPSTASVVIAEAMSVD
DRNEDIEQLESDTTHNSADQLQSSSADQQSMKKSVDSRSSGISADRNLVRSTVVAPGYVP
TEADERIIIELPSLMVRPLKVVRGIFQFPLKLLAGIIHSCNFVPRYLLRRSALELFMVDR
SNFFFDFGDMEARKNAYRAIIHTKPPNLNDIFLATQRAEQILKRTQLMERWANWEYPVFP
WIIADYQSKVLNLDDPSAYRDLSKPVGALNPERLKKFQERYSTFEDPIIPKFHYGSHYSS
AGTVLYYLFRMEPFTTLSIQLQGGKFDHADRMFSDLSGTWDSVLEDMSDVKELVPEMFYL
PEVFTNINSIDFGTTQLGGKLDSVELPPWAENPVDFVHKHRKALESEHVSTHLHHWIDLI
FGYKQRGKDAVMANNVFFYITYEGTVDIDKIADPFHLAADILLKMLKVQRRAMQDQIAYF
GQTPSQLLTVPHMKRKSLRDVLQLQTIFRNPSELKSYVLPNPERCNVPASTMLVSNDSIV
VVDINVPAAHVALHQWQPNTPDGQGTPFLFHHGRNAASSTGGAFMRMFKGSTSSGEDYEF
PRAIAFAASAIRSSAIVAVTCDKDIITGGHADCSVKLISPDGARTIESASGHLAPVTCLA
LSPDSNYLVTGSRDTTVILWRIHQAGFIHKKNPPEPPPATPRTPHSPLPTSPSSMSILLE
TRKCRIEGPMHVLRGHLGEVISCAVGPDLGLVVSSSNMSGVVLHSLRTGRLIRKIHVAEA
HAVSLSSQGIILVWSESKKRLSSFTVNGVPIATSVLSPFSGGVSCIEISMDGHFALIGTC
SSSNYKCEDNTEVADREPNKSSRKVDISEQTEIRQSVNVPSICFVDLHKLKVFHTLELGK
GQDITAIALNEENTNLLVSTADKGLMVFTDPALSLKVVDQMLRLGWEGDGLLQS
Download sequence
Identical sequences M7ZKG6
TRIUR3_14458-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]