SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_14606-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_14606-P1
Domain Number 1 Region: 120-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-22
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 328-423
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-18
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 3 Region: 1-79
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.49e-16
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_14606-P1
Sequence length 503
Comment pep:novel supercontig:GCA_000347455.1:scaffold79196:61074:63259:-1 gene:TRIUR3_14606 transcript:TRIUR3_14606-T1 description:""
Sequence
IPQKFVENFKGHISEVIKLEAPDGNIYNIQAIRDLNKIVLGPGWGVFVSFYKLKVGYFLV
FRYIGDSHFKVLIFDFGTCCEKEVFHVLMNCDPNAQEKESNSESHRRCELCDVHFYWHHL
DDRQKHFLRLMVGDFRREMSIPQKFVNNFRGRISEVMKLEAPDGNIYNFKVTKDLNKIVL
RYGWAAFASDYELKEHDLLVFRYIGDSHFKVLIFDPSGCEKQSVHIVLNHAPNVPKTGIS
HDRSFIRETRRRDCGSHDNNSRKTKKMTLVDSPSPRFAEGVTSPEVTMNSGGLREITELH
YVLATGCNLTTSQKAEVDALVKKVRPVIPFYITAMNKTSMSGSLVICKDYAAKYLPHEDQ
FITLCHPHKSNIWVDNLKVITDGSCMLSVGWSCFVLHNELRESDICLFEVSKNDGEVTMV
VHSLEGGHHLQGKKPESQNKCSYPVKVEVTEEEESDNELAESNYYYSRYAYDLTGKEQEE
IFRSALIQQGNPVYVAVLQENHV
Download sequence
Identical sequences T1MAI8
TRIUR3_14606-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]