SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_14607-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_14607-P1
Domain Number 1 Region: 355-455
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-20
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.47e-17
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 532-643
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-16
Family B3 DNA binding domain 0.0082
Further Details:      
 
Domain Number 4 Region: 194-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000353
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_14607-P1
Sequence length 649
Comment pep:novel supercontig:GCA_000347455.1:scaffold79196:69967:74423:-1 gene:TRIUR3_14607 transcript:TRIUR3_14607-T1 description:""
Sequence
LQTIPEKFVRSVGGKISELVKLETPDGNTYNVHIAKELNNLVLRSGWSKFARVYELQEGD
LLRFKYNGDSHFKVEIYDPSACEKETSCVVMNHNPGLQKRSVPRDNPMLSPEGERLAKRH
NGCCSDSCKTSKMNPAGTPHKPTKREAPSSEDARSSGELQTSTRSRYFLATGCNLTDAHK
VEVNKIEQNIRPEIPLYVKTIHSKTWGAHYRINADDTYHLSTGWLGFVDDNQLQKGDTCV
FEVLKRQRSFTMAVHLLKASYHHPPGFPASSKSLRPEAKSFRPADKVRLSRFTTLEGLLK
TKVYEKVEAIKPEIPVFVSIMMKTNVSSRSPNEMMGEKGCESCKKWQEHYYWEHMDVSKT
RFFKLMTQDSQQRIRIPDKFASNFIRQMQSPQGFDLKAPSGETWHVGVSKVGNDLFFSSG
WVDFAKAHELQENDLLVFTFSGNSFEVLIFDASGCEKLSSLFAGAGMRKHFDGKDLLPGS
PNCSSSCDVKHEETEEEESDDDTYADFDYCYSRVVKQLPDDEKHEIIGLTSLQRGNPAFM
TVLLRAHLQRKDNFLVIPSEFVHEHLHMRSHEVLLLRPNREERWHVSYYQGSSSKGFRGQ
PWVKFIHDNKLHKGDICVFELIKGARNENKKAGTTMTVHVVRRKKSDGR
Download sequence
Identical sequences T1MAI9
TRIUR3_14607-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]