SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_15739-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_15739-P1
Domain Number 1 Region: 2341-2634
Classification Level Classification E-value
Superfamily BEACH domain 1.44e-123
Family BEACH domain 0.0000000108
Further Details:      
 
Domain Number 2 Region: 2739-2997
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.5e-36
Family WD40-repeat 0.0068
Further Details:      
 
Domain Number 3 Region: 2178-2220,2258-2322
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-19
Family PreBEACH PH-like domain 0.0059
Further Details:      
 
Domain Number 4 Region: 1029-1164
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000412
Family Pentraxin (pentaxin) 0.068
Further Details:      
 
Weak hits

Sequence:  TRIUR3_15739-P1
Domain Number - Region: 722-781,837-1027,1272-1328,1443-1577
Classification Level Classification E-value
Superfamily ARM repeat 0.0201
Family Pumilio repeat 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_15739-P1
Sequence length 3017
Comment pep:novel supercontig:GCA_000347455.1:scaffold28305:53116:81924:-1 gene:TRIUR3_15739 transcript:TRIUR3_15739-T1 description:"BEACH domain-containing protein lvsC "
Sequence
MPTRPGDSTEEGVLSTLWQKYENAHDKEEKEKSLQIFVLQFVQTFRDWGPYHIEEFVDQE
LGSDETVVGCSYGHPSEVILILIQEISLITSTITESTRLANHQSCHMQASACRALLVTRE
PNPYHVALQDGVVIKGPDAMSKCGTSPESSPKHSDQLEPLELSAERLHVLECLTILTRSV
HNCRVFSYYGGVQKVTSLLKAAVDQLKALNSLHAVDDQSSDQAVENTRMMLKILICIITI
ISNFMKLEPTATRDPHFVDTTKYVRSSSYLATVSPSIPENTISDALQHWQQKAIILVLEA
GCVNRLVELLRVIQRLNLKEQWTDLSLHFTTLSTLRSTISGTHAQNHFRSIGGLEILLDG
LGLPSNKFSVSKHSSISRDERFGNINNLEFLCENGLVHKFANSISWPAFMIQESHRQKDT
TKTLLALNSISGPVHFLKITEWNDYSLKLSIALCSFILPSNVVKCCSDETAINQISASIP
SAYQEQSVRWMIRVLLTVFLCIKACACESELPSHIKILAKTIQIYTIRTFRRVLVSAPAL
LAAFREEGVWDLIFSEDCFYVGSSVEDIQFHIGTENQNDNVRNNRTATDSQSSYWIDVNI
LQVEAISFLEFAATLNENTYNLPECSALVDALEHCVSDAVVASILLKCFRVILQLATEQT
LASFKSLDAITRVLKVTCLQAQGLRNSRNLPRPEITIDRDDSQTKNIEMTSPEDRTDHTL
TCLKLGVNLLKDYVTISSDGRILVLHNAECIECLFNLFEEESLRKQVLEQVLALFRLPPS
SAQDHAAKLHLCSKYLENFTQANKNEKVNSELLIDLLVSMREIIMMDRVYYQNLFRNEGC
FLHIISLLNGTFNEATGERLVLNVLETLTLLLEENNASKAAFRVLVGVGYQTLQSLLLDY
YKWLPKRRRCCITFEHFTEAISDWQSSTSLQHYGLVVLQQLLKQSITNRTSSFRAGLLSV
LLDWFSIEEKDDTVSVIAELIQIIGAHSICGKDIRKIFALLRSEKISAKQKHTSLLLRSL
SHMLKEKGPEAFFEFSGHDSGIEIKSPFQWPYNRGLSFSCWLRVENFPENEDGRGCSAML
SKSALVYEVMVFFYLIFSQIRYAKVNEVMTRCTIGTELTPLGDEPNSIGFERTSAFTGQM
GPVYVFSDALSSEQIKGIYNLGPSYMYSFHGDDSLYRGILDARDGISSKIIFGLNAQASD
SKTLFSVSSTLDSADKSTVEATIIGGTKLCSRRLPQDIIYCVGGVSVFFPLFTQFCDAVT
NGGQYCYTSVINDKLAAEVIELVASVLDGNVSNQQQMYLLSGLSILGFLLQAAPPQLLNM
KTLPAVKYMFDVLRNCGMSKVLLKDAISRVYLNPEIWVYSNYEVQRDLYMLLIQYFETDG
RFLPLLCGLPRIIDIVRQYYWEKIDSKCVIGSKLLHPITKQVIGERPKIEEIRKLRLLIL
NLAEMSIKLKISPADIGALISFVERSQDVACIEDILNMILRALSHDSVLSSFLEHVLQEH
SQSDPSKDTNSNASSLDQFFLPRILVCIFKYMQSCQDSSARMRILTKLLGLLCSNPTNIE
ALMEHGWNSWLETSTNLDVIKEYKPAPKAELDNVEINELILVRKLYSLVLSYYLSSVKGG
WHQLEDTVHFFLLKFDQGQLSSSYLLRDILDDIVGSLLQTSSEENIFLSQPGCDNVLHLL
KLIQELLVNQIGIKLLFPSPSTTDESSSDDKWKLDIKLTVNEILDAETNGQCRSFPWSSC
QFAAGDEVSDDWWSFFDKVWSIICNLNGKGPSKLIPKSPQNVVAPSLGQRARGLVESLNV
PGAEMAAVVVSSGIAKMNIFADRATILREEIFPRIFFHLVILYLCKAGLENASKCVLQFM
SLLPLLIADDDQSKNKLHFLIWSLLVVRSQYGQLDDGARFHVLSHLILETIIYGKAMLVT
NILGRDDSIEVNSNKEAGFILSFIQKDRVLATAAYEVKHMHAVQADRLRNLQKLNSELNE
RFTKETQLVQIVDDQIHLSISSALSSDDSRKAAFQLAFDEDQQIVADKWIHIFRALIDER
GPWSANPFPNDALTHWKLDKTEDKWRRRFKLKRNYMFDERLCQPSSSRNEITEPFFDQPS
FSTKVPEKMKRFLLKGVRGITDDSGYGLFEDTNDTSESSHSPSENQNQNNAADSSDHRTT
VQNKKDTSSTNGDSDYTKVLCSVHCVLVTPKRKLAGQLNITRTVLHFSFDFLVEGTGGSS
VFSKFKDKKDSDRKNELGCAERLYGCRDSLIRINGGLMQNQSNKIKHHRRWNIAKIKGVH
WIRYLLQYTAMEIFFDDSNAPIFLNFSSQKDVKRAGSLLVSLRNDALFPKGSIKDKNSVI
SFVDRRVALEIAENAKERWKRREISNFEYLMILNTLAGRSYNDLTQYPIFPWVLADYASE
NLDFNKSSTFRDLSKPVGALDEKRFKDLEDRYLNFCDPDIPSFYYGSHYSSMGIVLHYLL
RLEPFTTLHRSLQGGKFDHADRLFQSIDGAYRNSLSNSSDVKELIPEFFYMPEFLENSNS
YHLGIKQDGEPLGDVALPPWAKGSPEEFIHINREALESEYVSSNLHHWIDLIFGYKQRGQ
PAVEAANIFYYVTYEGAVDLENMDDMLQKYAIEDQIANFGQTPIQIFRVKHPRRGPPIPI
AHPLYFAPQSITLTSSVSSTISHMSAVLFIGLLDNTIILMNEGLILSVKLWLTTRMQLGG
NFTFSGPQENFFGVGSDVISPRKIGTFLAENVKFGRQLLATMQINSDKYLILCGNWENSF
QIISLSDGRIVQSIRQHKDVVGCVAVSSDGNVVATGSYDTTVMVWHAFRGRPSERKMRTA
NFEISENDHIIMERPVHILCGHDDIITCLFVSTELDIVVSGSKDGTCIFHTLREGRYVRS
IRHPSGFGLSKLVATRHGRVVLYSEIDLSLHMHSINGKHIASATSIGRLNCMELSCCGEF
MACAGEHGQIVLRSMHSLDIVWKYAGAGKAITSLAMTPEECFIAGTKDGSLLVFSVETAL
IRRGSMPQTSVKPSGAG
Download sequence
Identical sequences M7ZWR5
TRIUR3_15739-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]