SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_23361-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_23361-P1
Domain Number 1 Region: 1626-1733
Classification Level Classification E-value
Superfamily Bromodomain 1.19e-27
Family Bromodomain 0.00034
Further Details:      
 
Domain Number 2 Region: 40-78
Classification Level Classification E-value
Superfamily TAF(II)230 TBP-binding fragment 0.00000183
Family TAF(II)230 TBP-binding fragment 0.0069
Further Details:      
 
Domain Number 3 Region: 570-647
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000492
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_23361-P1
Sequence length 1743
Comment pep:novel supercontig:GCA_000347455.1:scaffold130258:26016:41046:-1 gene:TRIUR3_23361 transcript:TRIUR3_23361-T1 description:"Transcription initiation factor TFIID subunit 1 "
Sequence
MAQGPAMYWSGCCTSKRRHAASDGGRGPPDDDDEDDYEEPGEGNRLLGFMFGNVDDAGGL
DADYLDEDAKDHLFALADKLGPSLKDIDLTKSSSAPDDPSEQDYDEKAEDAIDYEDIDEQ
YDGPEVEAATEEDHLLSKKDYLSSNTMFASVCSKVSVFDEENYDEDEEPPNDIELPGDYF
IQAEQLGISPSNDNPAIEMLSSSLPQLGESMDVEYEVCKEEIDIEEDQLESKSATSLPVL
CIEHGSAILKFSEVFGVQEPVRKAKTDHHKRPVSKDVRITNISDIVEDDEEVFLRCAIQD
VSSLKHIKMNEDFVESDSDELISSDTFGFKDSCLSEQPMKEAHKDFPTAQQAPVCPDVYP
LEHEDWENGIIWGNSPASESRSCLKSCVISEESSDTHSEDEAKDYGYVSRYCDVQSRNND
SPESFGYTEMPASASYHSPENSYPPLTKETSPEKNDLDHTEPNNINGTVKIVTMKCLSNL
SLLNKELLEGSWLDNIIWDHSEDAPKPKLIMDLKDDQMLFEILDEENRDHLRSHAFAMIV
SRSVRTSTVENFGHNNQIVTFDGQFNISNDKFYSNKEISQQAKSHTKKRSSMGIKVIILK
QFNRNSVTYQLFINKIKLFGSGKELQDDISLAMQNVRPNSILHVVRTEVHLWPKAQRLPG
KDKALRPPGAFRKRADLSVKDGHVFLMEYCEERPLLLANAGMGARLCTYYQKTSPDDQTA
TSLRSNNDGLGTVLAIEPADKSPFLGDVRSGSHQSCLETNMYRAPAFPHKVASTDYLLVR
SPKGMLSLRRIDKLYAVGQQEPHMEVFSPRPKNLQNYLLNRILVYVYREFRVRERPGVLS
QIRADEIPIEHPLTEVIVRKGLKHCADLEKGPNGHLFWTQRADFRIPSEDELRRLLSPES
VCCHESMQAAQHRLKHLGIHKLTQPVGLASAMDQLPDKAIELAAAAHIERELQITSWNLT
SNFVTCMNQFFIKLLHRVTENGFIRCTTSLGAPYVLLISQCLKFFWVQGCSLPLDRESIE
RLEISGIGDPSGRGLGFSYVRVNPVSNLPHKKKPAAAKGTTVTGTDADLRRLSMDAAREL
LLKFGVPDEQIDKLTRWHRIAMVRKLSSEQAASGIMIDEIPVSKFARGQRMSFLQLHHQA
KEKCQEIWDRQFQSLSAIDGDDNGSDTEAKSNLDSFAGDLENLLDAEEFDNEDVGTADLR
SDKGDDMEGLKMRKGSTQVQFNKENQDDQAEAALVKKLLEESGNDIKRKKEPVEMTNYGI
SMYNQGANKTKPSQSALALEESTPRGVKEEKRQGAKVDSLICGACGKLGHMRTNKLCAKY
GQDPETSGLDVISYISNPFDEASYVETTKPPGRRLVAKVSSEVPETEGPDCIEMIKPVKF
RCGAPEKSLDRNMSVAGSLVSDKLTMDANDLRSTGNASKIKICSKTKSEDYPPDTPKPSI
VIRLPAKAEKDVPRKKVIFKQPEGHVGQLTVIENRSGQEPRKLRKISELPSFKENIREND
GWYAGEPCQMNSSQDRLGLDGNRKSKVVGSDESWSAFKEQRVIQERRLIQARMQELSREE
ELQKSKRKNKKKKRHEFRDDDVLDHRPYRNDRRVPERDRATKRRTPADMTENAPSVKRRR
GGEVELSNILEKIVDLLRNQTSISLLFLKPVTKKVAPDYYDIIQRPMDLGTIRDKARKME
YRNREEFRHDVAQIATNAHIYNDTRHPHIPPLADQLLKICYCLLEESADALDDAESAIEG
LAQ
Download sequence
Identical sequences M8APU4
TRIUR3_23361-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]