SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_23520-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_23520-P1
Domain Number 1 Region: 216-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000235
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_23520-P1
Sequence length 380
Comment pep:novel supercontig:GCA_000347455.1:scaffold50484:9937:13053:-1 gene:TRIUR3_23520 transcript:TRIUR3_23520-T1 description:""
Sequence
MGVREIRTHNYQHWQPPAPQLGVAAAPRQAPMGAGVFGDWTMYNVNSTILSVACGSNSGN
NNGYHQSSRLCSATAWPNNFMPPPPSSYSVYPHGIQQQQQQQQGHQQAITYNANNNHQQG
FVSNFSVDPPLLPAQCFQPISPVPNNHSPPQLFEESRYAKRAKRRTQKRKNSEDPPEVGS
ENSGGLDHTMMLDGNHNFSNLGRQIFTTRFNCKDYHMVVWKELTNSDVGNIGRIVLPKRD
AEANLPALLERDGLILKMEDMRLPVTWNFKFRYWPNNKSRMYVLESTDCPWGEGDWAVRY
LNLSGMQGARPHQQQTMRVHQKPARQEKKIDACRLHLSTITMMHVVHVDLLHNTYLEAIT
KSRNSQKHRRESRITLNYHR
Download sequence
Identical sequences T1MZM8
TRIUR3_23520-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]