SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_24703-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_24703-P1
Domain Number 1 Region: 107-196,337-385,415-475
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.7e-25
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 
Domain Number 2 Region: 192-263,295-332
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.44e-16
Family Calcium ATPase, transduction domain A 0.0068
Further Details:      
 
Domain Number 3 Region: 468-508
Classification Level Classification E-value
Superfamily HAD-like 0.0000124
Family Meta-cation ATPase, catalytic domain P 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_24703-P1
Sequence length 640
Comment pep:novel supercontig:GCA_000347455.1:scaffold3210:55078:58533:-1 gene:TRIUR3_24703 transcript:TRIUR3_24703-T1 description:"Phospholipid-transporting ATPase 1 "
Sequence
MDPPARMPDPVPSPILKHSPSVSRSLRSAPDTSSVTFAADFRSPSKPESTSPSFDSFRTA
RSRPSSVSRSSTRRSASERAGSQRDLRDEDARFVYINDAPRTNAPPAMFPDNSIHTSKYS
VLTFIPRNLYEQFHRVAYIYFLVLAVLNFVPQLLVLSKEAGVLPLAFVLGVTAVKDAYED
WRRHRSDKNENNRTASVLADGVFRPKRWKDIQVGDVVRLVANETLPCDMVLVSTSDPTGV
AYIQTINLDGESNLKTRYAKQETMSTPPEVLAGVIKCEKPNRNIYGFLATVDLNGRRAIS
LGASNVMLRGCELKNTVWAIGVAVYTGRDTKVVLNSSGAPSKRSRLETHMNREIIALAVA
LVVLCSVVSLLTGIWMGDHVDRLGIIPFFHKYDYSGAAEHGHGRYNWYGTGVQVVFTFMS
AVIQFQVMIPIALIISMELIRVGQAYFMVQDEHMFDEKSQARFQCRALNINEDLGQIKYV
FSDKTGTLTQNRMEFRCASVQGRDFSETDGGEEDGHAVQDGGEYKPAVNTAPKLTALLKD
GTGAKASRARDLFLALATCNTIVPIVEDTANPAAKLVEYQGESPDEQALVYAAAAYGHKL
VERTSGHIVVDVFGARQRYELNTPPVYCKKIFASHSIAGV
Download sequence
Identical sequences M8AGF3
TRIUR3_24703-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]