SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_25058-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_25058-P1
Domain Number 1 Region: 104-573
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.93e-91
Family Acetyl-CoA synthetase-like 0.00000669
Further Details:      
 
Domain Number 2 Region: 799-1102
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.53e-36
Family Quinoprotein alcohol dehydrogenase-like 0.0088
Further Details:      
 
Domain Number 3 Region: 591-655
Classification Level Classification E-value
Superfamily ACP-like 0.0000112
Family Peptidyl carrier domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_25058-P1
Sequence length 1209
Comment pep:novel supercontig:GCA_000347455.1:scaffold39708:5298:16231:-1 gene:TRIUR3_25058 transcript:TRIUR3_25058-T1 description:"Acyl-CoA synthetase family member 4 "
Sequence
MASSTLGFGLLSFSVGECRPRSSWQCKSRAASRTRLTALRAGTLPDSLRPCFTRGDHLSA
VLCFLALAPASTAMTPPGHIWMCPKQMCPRQTPYLKGGAGATPRVVGVYASPSVEYVAAV
LAVLRCGEAFLPLDPSWPEDRVRSAVSASNAALLVSAGVSHEDDVLKGCSCPVLRLNGDI
RQGLYDGEVGIGGDELAWPCEHERPREFCYVMFTSGSTGRPKGVCGMEKGLLNRFLWMQR
RNPLCSDDVLLFKTSVSFVDHLQEFLSAVLTSTTLVIPPNNWRANPASLANLIKAYRISR
VTIVPSLMEIILPTLEKNISCGYNSLKILVFSGEILSLVLWKRVREILPETTIINLYGTT
EVSGDCTFFDCKDLPAILEREEITSVPIGFPIANCEVFLVKHAGIAAEGEICVSGACLFY
GYLAEFLRSNHTEGSESSKYYKTGDYARRLKAGELVFLGRRDRSVKNYGQRFSLEEVEST
LKEHPAVSDAAVTFQSKGSPDYKAYLVFKNKDEIVKDSVQYREVNSSQDVMASIRSWLIK
KVPPAMIPSFFLHVKSLPLTSSGKVDYVKLSSLECALEPCGIEQIKSGSGPVNPYLQVIK
KAFCDALLVDEVSEFDDFFTLGGNSISAAHAAHKLEIDMRLLYIYPTPSMLLHALVVEHS
NLVSPTDEPQPKKGLNVSTSIHGLFDPVAANVDDSYHGGKARINGKRAHYQIAGSYGNET
DGQLNKYPFSPDDRCQVNDLYLDTCLKYRNSVMGSQWILNFCLHKKWSIGRCNRFMHDDE
GKLQLEDVCSHVSYNKRGYLQELWNIPLDSCVDASPLLVLNNGMINIFIGSHSHLFLCID
CCNGSVRWSVKLEGRVECSAAITGDFSEVVVGCYKGKIYFHDMLTGKLSWTVQTDGEVKM
QPVVDRTRNLIWCGSYDHHLYALNYQDRCCAYKVSCGGSIYGSPAVDMAHDMIYVACTSG
LVTAISLEVPSFRIVWQYEAGEAIFSSLAIDHQSGNVVCCLVNGLVIALNSHGTVVWKAT
VGGPIFAGACVSSALPSQVLIPSRDGSLYSFDITSGDLLWSYDFGDPITASAFVDEVLAS
TPSGTSERFACICTSSGKVRVLGIRADAEQGKVGYSVQEFAAMDLPGDIFSSPLMQETCS
FGKMHSTQISDTSSRTVNKDMQKVLVLGFQRLDFHAINLWLSARYSVSQSDYNLGAIPSV
LGSKAEAEP
Download sequence
Identical sequences M7ZVF9
TRIUR3_25058-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]