SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_25356-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_25356-P1
Domain Number 1 Region: 43-91,207-317
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.35e-42
Family Calcium ATPase, transmembrane domain M 0.00000788
Further Details:      
 
Domain Number 2 Region: 90-203
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.23e-28
Family Calcium ATPase, transduction domain A 0.00012
Further Details:      
 
Domain Number 3 Region: 311-372
Classification Level Classification E-value
Superfamily HAD-like 0.0000198
Family Meta-cation ATPase, catalytic domain P 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_25356-P1
Sequence length 382
Comment pep:novel supercontig:GCA_000347455.1:scaffold148:24686:26303:1 gene:TRIUR3_25356 transcript:TRIUR3_25356-T1 description:"Calcium-transporting ATPase 1, endoplasmic reticulum-type "
Sequence
MGKGGQDEAARPDGSGSPGADPDVPVFPFWARTPSDCLAELGVSADGEVRATAFVEPLVI
FLILIVNAVVGVWQESNAEKALEALKEIQSEHATVKRDGRWKHGLPARDLVIGDIVELRV
GDKVPADMRVLQLISSTLRVEQGSLTGETSSVNKTSHKIHLEDTDIQGKECMVFAGTTIV
NGSAVCVVTGTGMATEIGKIHSQIQEASQEEDDTPLKKKLNEFGEALTAIIGVICILVWL
INVKYFLTWEYVDGWPANFKFSFEKCTYYFEIAVALAVAAIPEGLPAVITTCLALGTRKM
AQKNALVRKLPSVETLGCTTVICSDKTGTLTTNQMSAMIAKIAALCNDASIAHSEHQYVA
TGMPTEAALKGAVNGGTTMLKE
Download sequence
Identical sequences M7ZDN1
TRIUR3_25356-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]