SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_28877-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_28877-P1
Domain Number 1 Region: 495-602
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000165
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_28877-P1
Sequence length 623
Comment pep:novel supercontig:GCA_000347455.1:scaffold42947:20617:23992:1 gene:TRIUR3_28877 transcript:TRIUR3_28877-T1 description:""
Sequence
MADEAAAASSMQAAAAAALASLHLPPPGLTETDNQDRKIFGRGARIKRKAKRKWGFVGGE
AGAVDSGGLRPRLSHRRSTCRGGVGSMDEVLHGEVGIRSRFSAGRIREIMRGLTPRQQGY
VAKYGFEHFNRIGAFSVHEPLTEWIMGKINPPFSEFRINADKTIVFSKPLVQKILGVPTG
GRPFVLHGQKSDKIKELRDLYLNNGLRATIPHCVSLLKNNEDEESFMRTCLLIALAAVLT
PTTGNTIDLDYLWAFEDMSKVHDLDWAGHITEHLMDEVQKFQYKSREEKMRDFWVGGCLP
LLTLWQWCASVKLIIAYMDHLDLPRGRIVDHEINYSVPRICHVSKDDFQFAAIADLHRQH
FKFATFGILPFRDRTPYTDNPVTDTEVAADDLRILSNDQVLSGQWELVEVHEQKIDELVK
ETQPEALGFAEASIDHFRLGRTDIGSNQVEDSAREYESSESDDHLTPPEADYGVIFRSYL
SGTQMERVNMLIHKIKPETIVFVATMRKCDVQLPTPLLIISKERSLAAAAHFPHENGAVT
LQMPGKSEKWRPRFFIEKDNCMLAGNWLDFVCDNQVQVGDICIFVPEKGGERSTFTVHII
RAEATHRRGVKRVRSSLDSPGGV
Download sequence
Identical sequences T1NE80
TRIUR3_28877-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]