SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_29272-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_29272-P1
Domain Number 1 Region: 244-491
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.49e-39
Family Transglutaminase core 0.0000693
Further Details:      
 
Domain Number 2 Region: 14-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000517
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_29272-P1
Sequence length 811
Comment pep:novel supercontig:GCA_000347455.1:scaffold48918:69395:81868:1 gene:TRIUR3_29272 transcript:TRIUR3_29272-T1 description:"Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase "
Sequence
MVARRFVVREVPADEEHTVEYDTEDGLDVLRFQIFSLTSVPPDLQKIVVEADGSVVNDGT
DLESIPEGLCLMSIDEGENADSASAAATAQEKSDEELARLIEIEVDADGSVVDDGTDLES
ISEVLRLVPIGEGDDMDAAAAVAARAQEKSDEELARMIQVRFRYDIPGCIGWSSADKHIN
LLHRLSDAIVRQKGKFPRGLPSSPTKHRYDDTEMAIWAEEEALLLQQYSIQSDGGEVFRE
RVEPYMRQVLKYEDPVRQEAALKTVPVDELKEKALISLAKMISVLCLIWFHESNYRWEDR
RLKIELIYASSFNIDAYLCKWVNNDAYLAYWLTVILVLADGLMHQLVTSVTVKHLWCNHC
SSITRFPRYNDPYKILDFTDHVWTECFSNLYGRWIHLDPCEGVYDNPLLYEKGWNKKLDY
AIGISKDGVHDITKRYTRKWHEVLSRRTITSEDTVSAILMNITRKCRSGLSSNEHLALEK
RDRKESEELSKATYLEVNNSISLPGRQSGSVEWRAARSELGQADSLSCSSCPIRRCVDAH
VSKIHDALSAILSHFCDNNIPNERIIEVFVTLRSLMQNLKDANFKSRRVTLDQKSQQIFE
ILPSAERLLSAISLKAELHTVGDPSVATDGNLIHTSLALPVALDAVDEILSNYKSNIFYT
KGHQFPRGNRLCSGSVLASSEQLATAAFDGIRLSKWEEPDGAKGCWLMYKVHGGQTCELE
SYDLMSANDAPERDPMDWVLEGSTDQGSTWNTIDARSSVIFGSRFCRKSFTVDKRYKANV
LRFRFLRGRESSANPRFQIGSIDFYGETHMA
Download sequence
Identical sequences M7ZNJ6
TRIUR3_29272-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]