SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_29464-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_29464-P1
Domain Number 1 Region: 68-242,315-455
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.5e-71
Family TK-like PP module 0.011
Further Details:      
 
Domain Number 2 Region: 390-581
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.69e-58
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.051
Further Details:      
 
Domain Number 3 Region: 567-703
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.36e-35
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_29464-P1
Sequence length 807
Comment pep:novel supercontig:GCA_000347455.1:scaffold2868:8380:12150:-1 gene:TRIUR3_29464 transcript:TRIUR3_29464-T1 description:"Putative 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic "
Sequence
MALQASLPSAFLAAPTIAHASCPRQFKLRASAAAAASSASAGDGKVVTRKEPTTGAWKIE
YSSEKPETPLLDTINYPVHMKNLSTTDLEQLSAELRAEIVHTVSKTGGHLSASLGVVELS
VALHHVFDTPEDKIIWDVGHQAYPHKILTGRRSRMHTMRKTSGLAGFPKRDESAHDAFGV
GHSSTSISAALGMAVARDLQGKKNHVISVIGDGAMTAGQAYEAMNNSGFLDSNMIVVLND
NKQVSLPTATLDGPSKPVGALSKALTKLQSSTKFRRLREAAKTITKQIGGSTHEVAAKVD
EYARGMISASGSTLFEELGLYYIGPVDGHSLEDLVTIFEKVKSMPAPGPVLIHIVTEKGK
GYPPAEAAADKMHGVVKFDPTTGKQFKTKSPTLSYTQYFAESLIREAEGDDKVVAIHAAM
GGGTGLNYFQKRFPERCFDVGIAEQHAVTFAAGLAAEGMKPFCAIYSSFLQRGYDQVVHD
VDLQRLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPADEAELMHMVATANA
IDDRPSCFRFPRGNGIGAVLPLNNRGTPIQVGKGRVLVSGNRVALLGYGTMVQACLKAAE
ALKEHDLFITVVDARFCKPLDTELIRELAAEHEILITAEEGSIGGFGSHVAHYLSLNGLL
DGPLKLRSMFLPDRYIDHGAAEDQMEAAGLTPRHIAATVLSLCSACFDGIMGMDGLASGV
HVVRWQNIPRCHDFHELLASFFGVLARSHIKNHDMTSCMACFDGIMGMDRLAYGVTWLSG
RIFFLDYGVFSMWSPSQEDQAEDPRAG
Download sequence
Identical sequences M7ZHL8
TRIUR3_29464-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]