SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_32260-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_32260-P1
Domain Number 1 Region: 230-326
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-20
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 20-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-18
Family B3 DNA binding domain 0.0096
Further Details:      
 
Domain Number 3 Region: 446-551
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-17
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_32260-P1
Sequence length 555
Comment pep:novel supercontig:GCA_000347455.1:scaffold4900:17539:21511:-1 gene:TRIUR3_32260 transcript:TRIUR3_32260-T1 description:""
Sequence
SQMEKLCDCCKRYADHLDEKMKCFRRHMGADFRHGMIIPKKFIDNFGGKISRTIELESSN
GNMYVFEVSKLMGNTVIHRGWQAFIDELHIIENDSLLFRHIEKSRFEVLVLDSDDCEKVF
FCPGINLNSVNISNGSRDNATRSSGSKRFATCGRGNSSHPRKAAKTALNYSSPENSEEGT
EDIPSEHESYFELDDGHTPSRQDYVLARGRTLSRVQDEKVTTLIQDVGAEIPVFVAVMKP
SYVKSQTSALVIPKGYAVEHLPSKSQTVTLQRPGKSKKWHPRFYIRKDTHGSILCGPGWL
EFVCDTRVQVGDICIFERMKGTGRTFSLRVHLLRKSMLHSGGSGTGPKRVSSTHGKTRVN
SATPKRACITDGRTRAKATSTTCVRKEPGDGGNAPYSVRSHGHEARQGPVESDKSRGPWK
RPYVISSTACLTREQEMNVDKRGRALQSKVPIYVSIMNKSSVGNSLYTVNICREYAAEYL
AAGEQTVTLVTAEMSKAWEVKVHPRNGRAKVLRRGWHKFARDKHLKVQDICLFQLLTDQR
KLTMMVDIIRHHENQ
Download sequence
Identical sequences T1NND6
TRIUR3_32260-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]