SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_32580-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_32580-P1
Domain Number 1 Region: 222-317
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-17
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_32580-P1
Sequence length 341
Comment pep:novel supercontig:GCA_000347455.1:scaffold236186:15556:21126:1 gene:TRIUR3_32580 transcript:TRIUR3_32580-T1 description:""
Sequence
MAANGFGCHEWEAYLLHEANYSAPPDMRVLGLRRLTAGCVLVPLQPNNDRFHGEIARIRA
SLPEEVRGHPEYTANNHTQWAAYFQCRHEEQLASTNNGPVRGVHNTDSHRPWWGVPGCTL
HFVLEHLEGGNEPPFEYPATPAPDGDQCKRIVQSRCMESSDVQGTSPLPDRVKDEQMETP
LCPSKQLPDAHPIKPKVEPCENSLSPAPDASEDCETTPLSCNHPFFTVILSRSHVQKPFQ
LYIPGRFHKHLPEERTSATLICRGRSWAMRYCGDLKTKRLDADWMDFAVDNRLQVNDACV
FELVTGTREEVVFQVQILRGGLPKDITSKGYTADEPLVIVG
Download sequence
Identical sequences T1NP92
TRIUR3_32580-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]