SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_34721-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_34721-P1
Domain Number 1 Region: 226-305
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.79e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 305-381
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.72e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 3 Region: 381-457
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.96e-34
Family Ubiquitin-related 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_34721-P1
Sequence length 458
Comment pep:novel supercontig:GCA_000347455.1:scaffold23939:32268:38884:-1 gene:TRIUR3_34721 transcript:TRIUR3_34721-T1 description:"Polyubiquitin "
Sequence
MTSACCAAARDPPPVLLLARPGPGFHFMKKPSREELHLVRGPCRAGAAARVLGGFVGTGD
LADFWHTARGQGSLLGARYVDGAWRRLHGGGARGRGLEKTVLTRWRQKAERAMRDWARRI
NYFLSLRLEVLDCLIVVELEMEIPRLSGGGPIVGGKASLVSWEELHLVRGPCRAGAAARV
LGGFVGTGDLADFWHTARGQGSLLGARYVDGAWRRLHGGVARGRRLEKTMQIFVKTLTGK
TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGQ
Download sequence
Identical sequences M8AJB6
TRIUR3_34721-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]