SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRIUR3_35130-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_35130-P1
Domain Number 1 Region: 138-237
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.22e-20
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 343-440
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-17
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 3 Region: 1-79
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000196
Family B3 DNA binding domain 0.0041
Further Details:      
 
Weak hits

Sequence:  TRIUR3_35130-P1
Domain Number - Region: 506-540
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00981
Family B3 DNA binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_35130-P1
Sequence length 548
Comment pep:novel supercontig:GCA_000347455.1:scaffold30348:22495:24833:-1 gene:TRIUR3_35130 transcript:TRIUR3_35130-T1 description:""
Sequence
IPQKFVENFEGQISEVIKLEAPDGNIFNVQATKDLNKIVLGSGWGVFISFYEVKEGYFLV
FRYMGASHFKVLVFDFASCCEKEVLHVLMNYGPSAQEKDIRLDQSPLSERRCQNGGSRNG
GSHRRCEHCDVHFYWHHMDDRQKHFLRLMFGDFRQEISIPEKFVNNFRGRISKVMKLEAP
DGNVYNIQVINDLNKIFLRSGWAAFASAYELKEHDLLVFRYIGDSHFKVLIFDPSGCEKE
LFHIVMNHTPNLQETGISHDQPFLKETRRHCESRDYNSRKTKKMTPLDSPSPRSAEGVKS
PEDTLNSGGLRETTKPRYVLATRCNLTTAQKAEVDALVRKVRPAIPFYITAMSKTSISGS
LVICKDYAAKYLPDGDQFITLCHPHKSNIWIDNLKVITDGSRMLSVGWSCFVLHNELRES
DICLFEVWKSDGDVTMVVHSLEGGHHLQGKEPESQKKRRYPVKAEATEDEESDKEHAESN
YYYSRHANGLTSDEQEDIFRSALIQQGNPVYVAVLGKNHVKKGNNLLTIPRKFAAKHLAA
RSHDILLL
Download sequence
Identical sequences T1NW75
TRIUR3_35130-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]