SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|171737|estExt_Genewise1.C_100785 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|171737|estExt_Genewise1.C_100785
Domain Number 1 Region: 103-210,297-346
Classification Level Classification E-value
Superfamily E set domains 0.00000000728
Family Cytoplasmic domain of inward rectifier potassium channel 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|171737|estExt_Genewise1.C_100785
Sequence length 347
Sequence
MVHRNLPFHQSRNNVRMKNSDTKLLWRLMILDWFHSLLRLPAYLSISFLLFLWILLVVFY
AGCLVPTVKWGYRHGLPGASDAFFEEGCELLVITIFTQMMWSMMFNAFLFSFFFSLMSKS
EFRSSQIIFTNKLLINVNTDGKKAYARLQCYDIDSSHPLVEAHARMYVLDHKLKMHPLRL
ADPNDDLGGVLYPSVPSDIVHLIDHHSVLSPRSKCPLIESSNGLTLRSVDSHTGNRDEII
CPICGEAYGTYKRLQKHIDYNAMIESTTSTTENNFVFQKGKSHIDFVVPKIEPLTLEEVR
NHIEHTLSEIIVVVEAIDPQLSGTFQSLQSYKYKDIVFGAEFTNCMS
Download sequence
Identical sequences jgi|Fracy1|171737|estExt_Genewise1.C_100785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]