SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|235153|fgenesh2_pg.2_#_1261 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|235153|fgenesh2_pg.2_#_1261
Domain Number 1 Region: 44-92,138-264
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000845
Family Phosphate binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|235153|fgenesh2_pg.2_#_1261
Sequence length 373
Sequence
MIFRDSAIVAALTATLFAVAASEALDPTSLNGESFKITLVEADGFVNSEADGEFSGYIID
MIESVAKKAGFEYDLLLPSGYGDNCPSILDANYLGFNANAVDYLKTAGVDPYNAVYASSY
LCGQNDVIGPGDIPEESQTDMYWSMYYVTTSRQLAGKFSVAFKPPTQGLTMYGTQTGVGS
FEDLITQQKDDKVGAACIGGNTAYAAWLANALPDLQTIEIENTEAAAEKALESGKCTVII
NAEHAALKFVNAHFLKGKCKIDGKPVGIIGEGLQYGLTQMAIGFNDNVPEDTIRVISYWM
NDLMTCAPNDEGCGGSLYASWLAKFGTSDACGYVSDPEPSDMSGSSAITTVATTVVAGAV
TAFAAIVGEGLLA
Download sequence
Identical sequences A0A1E7FTN8
jgi|Fracy1|235153|fgenesh2_pg.2_#_1261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]