SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|238249|fgenesh2_pg.5_#_753 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|238249|fgenesh2_pg.5_#_753
Domain Number 1 Region: 50-80,125-293
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000536
Family Phosphate binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|238249|fgenesh2_pg.5_#_753
Sequence length 378
Sequence
MIFRNSAIFAALTATLFAVAASEALDPTSLNGESFKITLVEADGFVNSEEADGEFSGYII
DMIESVAKKAGFEYDLLLPSGYGDNCPSVLDANYTPEEGSNSTTAAVDPYNAVYASSYLC
GQNDVIGPGDIPEESQTDMYWSMYYVTTSRQLAGKFSVPFKPPTQGLTMYGTQTGVGSFG
DLINQQKDDKVGAACIGGNTAYAAWLANALPDLQTIEIENTEAAADEALESGKCTVIINA
EHAALKFVHSHFLKGGCKIDGKPVGIIGEGLQYGLTQMAIGFNDNVPEDTIRVISYWMND
LMTCAPNDEDCGGSLYASWLGKFGTSDSCGYVSDPVPDNVEFLPSDMSGSSVITTAATTI
VAGSVTAFAAIVGGGLLA
Download sequence
Identical sequences jgi|Fracy1|238249|fgenesh2_pg.5_#_753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]