SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|270507|estExt_fgenesh2_kg.C_130010 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|270507|estExt_fgenesh2_kg.C_130010
Domain Number 1 Region: 173-199,234-286
Classification Level Classification E-value
Superfamily E set domains 0.0000000496
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|270507|estExt_fgenesh2_kg.C_130010
Sequence length 378
Sequence
MLLEVIATIVNGGGSSNRPLPSVIREQLIMDEDKETIRTLHHTIQRKARQRLIIGRSRNS
RVNDNENEDENENESEISGGSRDDVIIPVQVPDDATVVLQQDVKARLSVDGTALRADDDA
PIASLRHTITTTTHNNNIDDSNNNNASVDVVVDCQLTILEAPPLPTLTTRLLLPRLLQLV
PLWGPEEGGTLIRLHGEGLFSQSLPLLQTMAGEAAAADSTTSSSSNNNNNNNNSNDRGVP
HVRFGSVSVPCERINDTTLCCLSPPHPPGIVKVSLVRCRHISHSNNNNNNNNINNNSNLT
GNNNRIILEEDDDDEELQDETTFEYVRMGAAFDAIFATTNSYCPLRSRQKQDHTDNNGVL
DNNNNDDDDDDDDNGFTG
Download sequence
Identical sequences A0A1E7F2J9
jgi|Fracy1|270507|estExt_fgenesh2_kg.C_130010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]