SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|81268|estExt_Genewise1.C_21392 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|81268|estExt_Genewise1.C_21392
Domain Number 1 Region: 459-817
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.53e-68
Family PFOR PP module 0.0000213
Further Details:      
 
Domain Number 2 Region: 1088-1293
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.54e-58
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000165
Further Details:      
 
Domain Number 3 Region: 788-942
Classification Level Classification E-value
Superfamily Flavoproteins 4.89e-38
Family Cytochrome p450 reductase N-terminal domain-like 0.034
Further Details:      
 
Domain Number 4 Region: 1376-1507
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.55e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000013
Further Details:      
 
Domain Number 5 Region: 954-1087
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.32e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.0012
Further Details:      
 
Domain Number 6 Region: 1295-1373
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.85e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.00075
Further Details:      
 
Domain Number 7 Region: 7-197
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.12e-16
Family PFOR Pyr module 0.00028
Further Details:      
 
Domain Number 8 Region: 346-447
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000738
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|81268|estExt_Genewise1.C_21392
Sequence length 1529
Sequence
MGSISTAGEAVARIAHQASDVIVSVVPSLSTESEFSEALKSLQKHNAPSVVSKTLPEVVT
VRQNADPLLSVFQPIRAGKLTSVTTTSSILVKSIPHLYKLAQYPVVIHVSVAPSGYPDFS
DITSIRQSGFAFIQSETLQELQDLALTAHALAVKSGKGVIHFFDSGASAFRKTVEVEDAA
LVRSVIDMDAVAAFQNSKSQETSLYADDGRAPSLSFARSQTVNAAPTSALAGAPDQSKSL
PVSERNSQRGDSSSGSSVREASTSAASVSSATTVESLISKPVSSEDIYRFATQIWSTIRD
ATGRSYDAFAFSGTGKEEAAIFLFGADTAVFATELDSVDETKAYANTAIITARLYRPWLG
SSLAPMLPSSLKRIAVIEQVRRKTTRWGPVLLDVLMSLKASGGASPTVVGYQLGYINEET
VSQAMRGVWQNLMSETPVQNLVIGNLDGPEAQPTKIEQPALENAYIKILNQVFGEKLHVA
NQLESQHAGISNEIASTPEYGFGSLVARKEHRKRFVEEAAAASKDNKFITQAPQQWLSKW
ALSADDTDKANELASEVIARLSTDGSPIASQLLSSKKLFYKESPWLIGSDAWAYDLGNSG
VHHVLASGENVNMLIIDSTPYSERAAADAARRKKDIGLYAMNFGNAYVASVAVYSSYTQV
LEAMIEADKFNGPSVVLAYLPYEKENDTPLTVLQETKKAVDLGYWPLYRWDPKAEEKGEV
NFKLDSERIKKELEEFLSRDNYMSQVMKRHPEFASNLSGSYGTEVRQLQKRKAKDAYSKL
LEGLQGDPLTILFASDNGNAENLAKRLGNRGKARGLKTIVMAMDDFPLEDLPNEQNVVLM
TSVAGQGEFPQNGRAFWEAVKDSTDLDLATVNFGVFGLGDSHYWPRKEDKIYYNKPAKDL
HARLLTLGGKPLVDCGLGDDQDPDAYQTAYAEWEPKLWEKLGVSNVENLPEEPAPLTNED
MKAASNYLRGTIEEGLADTSTGAISASDQQLTKFHGTYMQDDRDLRDQRKAQGLEPAYSF
MIRCRLPGGVSTPKQWLQMDEISSTLGNETMKLTTRQTFQFHGVVKGKLKPAMQAINKAL
MTTIAACGDVNRNVMCSSLPTQSKYHGQVHRYAQKISDHLLPSTTAYHEIWLEDDETKQK
RKIAGEAVQDHEPLYGPLYLPRKFKITIAIPPHNDTDVYAHDIGLIAIKGEDGNLEGFNV
LAGGGMGVTHNNKKTYPRTGSMFGYVTADQVHLVCEKIMLVQRDHGDRKNRKHARLKYTI
DDMGLDVFIQKVEDLWGQKFSEPKPFKFQSNIDTFGWQKDELGLNHFTFFIENGRIEDTA
EFPMKTGLVEVAKAHKGEFRLTGNQHLILANVADEDLPAMKELLKKWKLDNTNFSGLRLS
SSACVAFPTCGLAMAESERYLPELITKLEGTLEESGLRQDSIVMRMTGCPNGCARPWLAE
VAFVGKAYGAYNMYLGGGYHGQRLNKLYRSSIKEDEILEIMKPLIKQYAKERNEGEHFGD
FVIRKGYINETTHGTNFHDNTAEAESDAE
Download sequence
Identical sequences M2TDD5 N4XNZ8
XP_014084257.1.79200 jgi|CocheC5_1|81268|estExt_Genewise1.C_21392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]