SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|92552|estExt_Genewise1.C_180289 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|92552|estExt_Genewise1.C_180289
Domain Number 1 Region: 152-419,450-497
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.09e-79
Family IF2B-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|92552|estExt_Genewise1.C_180289
Sequence length 502
Sequence
MSGEPATVPAPVPAPDSTVPAAVPAPAESAPAPANGDATDGPKKLSPAELKKQKQAEKQA
KRAQAKAAGGAPNQQQGPPKDGQKQQKDSKQTSKDDKSRPLPVRRRPSQQNVPNSKEPEK
KSKKDLSSKQTGLFFGHLYSQPKQQSLVGASKDVHPAVLALGLQYSSYTICGSTARMVAM
LLVFKTVIEAYQTPPGNSLARHLTSHHLGPQIEFLKSCRPLSISMGNAIRWLKDVIIKID
PSTPENEAKRDLIEEIDIFIRERVTAADRLIRDLAATKIQAGDVILVYAASSIVEQTIIH
AHESGIPFTVIVVDSKPLFEGKQLARKLANRGITVRYYLVTGASHAVKDATKVFLGAHAM
MSNGRLYSRVGTALISMLAYSHSIPVIVLCQSVKFTEKVALDSIVGNEVAPAEEMLSEAE
RRALLPLRSRLPSSKNDDKTGSEDAPADTTDVLKWIEEAKNLHHLQVLYDVTPAQYINMV
ITEYGSLPPSSVPVVHRLSTNI
Download sequence
Identical sequences M2TMV6 N4X4D0
XP_014077267.1.79200 jgi|CocheC5_1|92552|estExt_Genewise1.C_180289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]