SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|108540|fgeneshEH_pg.105__27 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|108540|fgeneshEH_pg.105__27
Domain Number 1 Region: 379-775,813-866
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-29
Family Calponin-homology domain, CH-domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1773-1887
Classification Level Classification E-value
Superfamily ARM repeat 0.000000151
Family Plakophilin 1 helical region 0.052
Further Details:      
 
Weak hits

Sequence:  jgi|Emihu1|108540|fgeneshEH_pg.105__27
Domain Number - Region: 1544-1615
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00903
Family Motor proteins 0.072
Further Details:      
 
Domain Number - Region: 1404-1482
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0122
Family Motor proteins 0.061
Further Details:      
 
Domain Number - Region: 1480-1551
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0165
Family Motor proteins 0.042
Further Details:      
 
Domain Number - Region: 1592-1663
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0324
Family Motor proteins 0.048
Further Details:      
 
Domain Number - Region: 1230-1294
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0584
Family Motor proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|108540|fgeneshEH_pg.105__27
Sequence length 1970
Sequence
MDLAEVEAKAPAARNAATSLEPVCVPAPLVLSSVATTPTVSFGTIAPRASVTRALAVKNV
APRPQRLEVRGVGRGGLSVQPPLLELPPHGEGELCVTWAPLSHGSIPKRLELLWNRSNTL
AVELKGLCAPAAPPGPTAAPPDVGDAILALATAPALCKAQAHDERMPLSPSRLTNNRASS
FSSKSRPRRNSRLGDDLLVFDEGAASLMASAFSAPPAAPPQPAAPPQPAAPPQPAAPPAA
ASVEVAAERRKLAEEHVEELEAKLKQVRRSKAPSVPGRLRLSKPPPRGAAPRGAPAGRLE
GAAALGGRTSGFFYDARWRERREAGFTTWFNFVVGGSRTVAPGGGVAGGGGGAGERQTLT
LMEFENRRQDAVNRRRMTTLLRGPSLRPVIARLEAEVESGLLCVRPSLNLAADVGQRDNL
LSLLGCYNPLWLRLALEAISGEMAPLGAAADDAHALRKWLDKRFLAPIRLDPAARPAAVA
AAAGRHPDKVWEEARAAAVGETHKCIVRRVLCVLLLLDRAKETTVLEADPCLFCPDSTIK
STRQMAIEFARSFLSGGIGDLAKHLAYMDAPLAHAQTAHHEFNFTVQSLATDLRDGARLC
RLLEVLEVASAPSGGAAALRLTPSLRLPAVNRTSKLKNVEIALRAMEAAGAPLLRHPPDL
HGCAKLLVEGHCEATLDLLWSLICHVALPRLAPVGIVLDEARRARRTANTDFAPAAPDGA
EQPAAVAALLCWVQSVAAVYRLRLSDLTGGLRDGRGLLALVHFYVPEALGDGFDARAELG
LQRPAGAEELLLEELEAGQWLRPVEGDTGRAAEAEARKAAKRRLSLFASSLHALGGVPQL
LIAADAVETGPDEAVAAVLLAHLFARVMELSTQTRAARLIQLSGCARGKRCVDPWKLMKQ
CVFAIRMQRRRRSSKQRADARAELRSRVVLSRAVGAWRDRVLFLESVRATRTIQAAGRRR
RAVARLSALRAAALALQHFLRRQAARSLAARASTRIQSAARMLGARHRLQAARLAAVRVQ
AAARRAAAASELRRQRCSRRLQAVVRGQAVRRALALDAAAATCVQAAWRASATRASFTSA
VATIVSIQSNVRCATAVRKLAMQRTSAVAVQAQARRLLAKAELRRHRQLHTEHIGCVKMQ
AAARRRAAVQKKRVQRAARKLQALARGGADRRSIARSATAAVRIQAVWRSAVCQEAFARS
VAAAVAMQAAGRRANAARVLRVSIAQCTRVQSLARGAAERRRCAARAAAAVTIQAAWRSV
TLQVEFAASVAAVVAVQAAARRLAAMRRLRVQRGCCTRLQSAARRQLAVRAARRERAARA
IQALRRGAAARQQVAVWHAAATRIEAQWRSARCQALLARSVAAAVAMQAAGRRANAARQA
HLRLVSIVLIQSSARRLAACADARRQRAARCMQAVSRGSAARRILALQASAAASIQAVSR
ANFCRQRFAAMKLAAVAVQAAARRAHAIQTLQWSRWAARYIQAVARGVAERRLADQWTLA
AMRIQASWRSLLAQAALAESIEAATVIQTAGRTFVARCLRERSQRAALLIQAVARGRIER
RLCDAWTLAAIAIQSAQRMAVCRRLIASSVRATVQVQAGARGLVARRVLRRCALACTRLQ
AAARRRASLVAFAELKRRHFAAIAIQSAGRVALAIKQSHAIRKVMHLAALAKLHQCARLV
QTRARFLTYRNCRRAAAAVIARRALTAITLRRRVRFVRVVVSLQAMLRARRTRSRVYRRH
PELRNIAARAADAYRKMLADPSLCLPARTKVALDILLTTKNLGQLLSALSSLEMFTLISP
RVAAAMVEVGTVPVMLQLLQLCNRSLPHQKAVGHVLRILANIGRTPSLRDRVWEQREVVP
TIVELAQNYREHEQLLRESLVVMQQLLVTGPREWRAHVFQKMPEFVKRLDSILALAKRKA
DKMAKEQRPPNAPSRRDAKKDPVKRAADPGPDNVTRLSQLVAALKGSAAA
Download sequence
Identical sequences R1FX74
jgi|Emihu1|108540|fgeneshEH_pg.105__27 XP_005792770.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]