SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|195779|gm1.300830 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|195779|gm1.300830
Domain Number 1 Region: 5-112
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000314
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 129-166
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000759
Family EB1 dimerisation domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|195779|gm1.300830
Sequence length 198
Sequence
MPTASRKELSEWAASLSGHSVSRELKELSTGVVLCHLVEAARPGSVEIRKLATMRSGSDT
IANLKLLSVALERVDPSGELAAACDVPLLAKGQPQATLALLQKLHSYFNAENNAELAADG
NSRSRSAAAEKKRTRVKPEMQQLRDERDFYLRKLSLIERAVSRAGNGEGEAEGAGVGALA
AEVQRILRCPEEELGSVS
Download sequence
Identical sequences R1EJL3
XP_005775585.1.92643 jgi|Emihu1|195779|gm1.300830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]