SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|199323|gm1.1000023 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|199323|gm1.1000023
Domain Number 1 Region: 60-156
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-22
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|199323|gm1.1000023
Sequence length 179
Sequence
MINEVVAGHPAARDTSTAAVEMTDVIPRAAQDKQVNNGIYVQPTEDGNFGLDKDIADNAK
KKYDIAKEQEVRTWIEKVLDEKLEDGLGALEFQKVLQSGVVLCQLANKIKKDVCKWPRST
SQPAVQRENISFYLKACEKLGMTDNFIFMTDNLFQESTGKASPAQMLQISTPLRCGMIG
Download sequence
Identical sequences R1FZD5
XP_005793555.1.92643 jgi|Emihu1|199323|gm1.1000023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]