SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|206480|gm1.2700001 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Emihu1|206480|gm1.2700001
Domain Number - Region: 40-78
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0756
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|206480|gm1.2700001
Sequence length 85
Sequence
MINEDTSTAAVEMTDVIPRAAQDKQVNNGIYVQPTEDGNFGLDKDIADNAKKKYDIAKEQ
EVRTWIEKVLDEKLEDGLGALEFQK
Download sequence
Identical sequences R1ENK8
jgi|Emihu1|206480|gm1.2700001 XP_005776945.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]