SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|209209|gm1.3700261 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|209209|gm1.3700261
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-27
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|209209|gm1.3700261
Sequence length 207
Sequence
MPLNSGALLGWCQRETATYDGVSVENWSRSWNDGLAFCALLHRHFPDDIRFGSLNSSTPQ
SRARNFELAFGVAERRLDVERLFDVEDMMATYPRPDGRSVTTYVVLLYNAIEERGMVAAT
PAVQLTPLPLPDRSEDDSALSPAELAMIRKCNQKMEALNAKLQHSPRSHVPTAEEQAMLL
SMAALNAALESDARNPARPRYGFMTTR
Download sequence
Identical sequences R1CA93
jgi|Emihu1|209209|gm1.3700261 jgi|Emihu1|252978|gm1.151700002 XP_005772017.1.92643 XP_005786416.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]